Invitrogen™ Human PHC1 (aa 142-225) Control Fragment Recombinant Protein

Product Code. 30212184

Brand: Invitrogen™ RP89502

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52370 (PA5-52370. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Polycomb group (PcG) proteins assemble into multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes throughout development. PHC1 (polyhomeotic homolog 1), also known as EDR1, HPH1 or RAE28, is a 1,004 amino acid nuclear protein that is a component of the PcG multiprotein PRC1 complex. Specifically, the PcG PRC1 complex modifies histones, remodels chromatin and mediates monoubiquination of Histone H2A. Other constituent proteins involved in the PcG PRC1 complex are Mel-18, Bmi-1, M33, MPc2, MPc3, RING1, Ring1b, as well as several others. Existing as a homodimer, PHC1 contains one FCS-type zinc finger and a SAM (sterile alpha motif) domain. PHC1 is encoded by a gene located on human chromosome 12, which encodes over 1,100 genes and comprises approximately 4.5% of the human genome.

Specifications

• Accession Number: P78364
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1911
• Name: Human PHC1 (aa 142-225) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW557034; DKFZp686A1782; early development regulator 1 (homolog of polyhomeotic 1); early development regulator1 (homolog of polyhomeotic 1); early development regulatory protein 1; Edr; Edr1; hPH1; MCPH11; Mph1; PH1; Phc1; polyhomeotic homolog 1; polyhomeotic homolog 1 (Drosophila); polyhomeotic-like 1; polyhomeotic-like 1 (Drosophila); polyhomeotic-like protein 1; RAE28; RAE-28
• Common Name: PHC1
• Gene Symbol: PHC1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LNQSQAQMYLRPQLGNLLQVNRTLGRNVPLASQLILMPNGAVAAVQQEVPSAQSPGVHADADQVQNLAVRNQQASAQGPQMQGS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining