Invitrogen™ Human PHACTR3 (aa 87-156) Control Fragment Recombinant Protein

Product Code. 30210677

Brand: Invitrogen™ RP106354

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65682 (PA5-65682. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is associated with the nuclear scaffold in proliferating cells. It was found to bind to the catalytic subunit of protein phosphatase-1 (PP1) and inhibit PP1 activity, suggesting that this protein may function as a regulatory subunit of PP1. Alternative splicing at this locus results in several transcript variants encoding different isoforms.

Specifications

• Accession Number: Q96KR7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 116154
• Name: Human PHACTR3 (aa 87-156) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1500003N10Rik; 4930415A02Rik; C20orf101; H17739; LOW QUALITY PROTEIN: phosphatase and actin regulator 3; mKIAA4224; Phactr3; Phosphatase and actin regulator 3; PPP1R123; protein phosphatase 1, regulatory subunit 123; scaffold-associated PP1-inhibiting protein; Scapin1; Scapinin
• Common Name: PHACTR3
• Gene Symbol: PHACTR3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KLKQTTSALEKKMAGRQGREELIKKGLLEMMEQDAESKTCNPDGGPRSVQSEPPTPKSETLTSEDAQPGS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining