Invitrogen™ Human PGS1 (aa 190-314) Control Fragment Recombinant Protein

Product Code. 30207402

Brand: Invitrogen™ RP93181

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54596 (PA5-54596. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PGS1 functions in the biosynthesis of the anionic phospholipids phosphatidylglycerol and cardiolipin.

Specifications

• Accession Number: Q32NB8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9489
• Name: Human PGS1 (aa 190-314) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610019F11Rik; 4933424M23Rik; CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase, mitochondrial; PGP synthase 1; PGS1; Phosphatidylglycerophosphate synthase 1; RGD1305052; Saf; silencer-associated factor
• Common Name: PGS1
• Gene Symbol: PGS1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VRVSLFHTPHLRGLLRLLIPERFNETIGLQHIKVYLFDNSVILSGANLSDSYFTNRQDRYVFLQDCAEIADFFTELVDAVGDVSLQLQGDDTVQVVDGMVHPYKGDRAEYCKAANKRVMDVINSA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining