Invitrogen™ Human PGD (aa 32-126) Control Fragment Recombinant Protein

Product Code. 30196944

Brand: Invitrogen™ RP94254

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83188 (PA5-83188. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

6-phosphogluconate dehydrogenase is the second dehydrogenase in the pentose phosphate shunt. Deficiency of this enzyme is generally asymptomatic, and the inheritance of this disorder is autosomal dominant. Hemolysis results from combined deficiency of 6-phosphogluconate dehydrogenase and 6-phosphogluconolactonase suggesting a synergism of the two enzymopathies.

Specifications

• Accession Number: P52209
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5226
• Name: Human PGD (aa 32-126) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 0610042A05Rik; 6 PGD; 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphogluconate dehydrogenase, decarboxylating-like; AU019875; C78335; LOC100360180; Pgd; PGDH; phosphogluconate dehydrogenase
• Common Name: PGD
• Gene Symbol: PGD
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining