Invitrogen™ Human PGC (aa 21-81) Control Fragment Recombinant Protein

Código de producto. 30194243

missing translation for 'mfr': Invitrogen™ RP94664

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56830 (PA5-56830. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Pepsin is one of the main proteolytic enzymes secreted by the gastric mucosa. Pepsin consists of a single polypeptide chain and arises from its precursor, pepsinogen, by removal of a 41 amino acid segment from the N-terminus. Pepsinogen is synthesized in the stomach lining, and hydrochloric acid, also produced by the gastric mucosa, is necessary to convert the inactive enzyme and to maintain the optimum acidity (pH 1-3) for pepsin function. Pepsin is particularly effective in cleaving peptide bonds involving aromatic amino acids. Pepsin shows extremely broad specificity, and although bonds involving phenylalanine and leucine are preferred, many others are also cleaved to some extent. The amino acid composition of Pepsin C differs from those of pepsinogen and pepsin especially in the content of basic amino acids, glutamic acid, aspartic acid, leucine and isoleucine.

Especificaciones

• Accession Number: P20142
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5225
• Name: Human PGC (aa 21-81) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2210410L06Rik; Gastricsin; pep carboxylase; PEPC; pepcase; pepsin C; pepsinogen C; pepsinogen group II; PG1; Pg-1; Pgc; PGII; preprogastricsin; progastricsin; progastricsin (pepsinogen C); Upg1; Upg-1; Urinary pepsinogen 1
• Common Name: PGC
• Gene Symbol: Pgc
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VPLKKFKSIRETMKEKGLLGEFLRTHKYDPAWKYRFGDLSVTYEPMAYMDAAYFGEISIGT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining