Invitrogen™ Human PGAP1 (aa 765-818) Control Fragment Recombinant Protein

Product Code. 30210572

Brand: Invitrogen™ RP103675

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64424 (PA5-64424. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Involved in inositol deacylation of GPI-anchored proteins. GPI inositol deacylation may important for efficient transport of GPI-anchored proteins from the endoplasmic reticulum to the Golgi.

Specifications

• Accession Number: Q75T13
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 80055
• Name: Human PGAP1 (aa 765-818) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5033403E17Rik; 9030223K07Rik; A530084K22; Bst1; D230012E17Rik; GPI deacylase; GPI inositol-deacylase; hPGAP1; ISPD3024; MRT42; oto; PGAP1; Post GPI Attachment to Proteins 1; post-GPI attachment to proteins 1; post-GPI attachment to proteins factor 1; SPG67; UNQ3024/PRO9822
• Common Name: PGAP1
• Gene Symbol: Pgap1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HLQASLTTFKNSQPVNPKHSRRSEKKSNHHKDSSIHHLRLSANDAEDSLRMHST
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining