Invitrogen™ Human PFTK2 (aa 344-429) Control Fragment Recombinant Protein

Product Code. 30209644

Brand: Invitrogen™ RP91449

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53383 (PA5-53383. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Protein kinases are enzymes that transfer a phosphate group from a phosphate donor, generally the g phosphate of ATP, onto an acceptor amino acid in a substrate protein. By this basic mechanism, protein kinases mediate most of the signal transduction in eukaryotic cells, regulating cellular metabolism, transcription, cell cycle progression, cytoskeletal rearrangement and cell movement, apoptosis, and differentiation. With more than 500 gene products, the protein kinase family is one of the largest families of proteins in eukaryotes. The family has been classified in 8 major groups based on sequence comparison of their tyrosine (PTK) or serine/threonine (STK) kinase catalytic domains. The STE group (homologs of yeast Sterile 7, 11, 20 kinases) consists of 50 kinases related to the mitogen-activated protein kinase (MAPK) cascade families (Ste7/MAP2K, Ste11/MAP3K, and Ste20/MAP4K). MAP kinase cascades, consisting of a MAPK and one or more upstream regulatory kinases (MAPKKs) have been best characterized in the yeast pheromone response pathway. Pheromones bind to Ste cell surface receptors and activate yeast MAPK pathway.

Specifications

• Accession Number: Q96Q40
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 65061
• Name: Human PFTK2 (aa 344-429) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ALS2CR7; amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 7; amyotrophic lateral sclerosis 2 chromosomal region candidate gene 7 protein; Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 7 protein homolog; Cdk15; Cell division protein kinase 15; cyclin dependent kinase 15; cyclin-dependent kinase 15; frizzled family receptor 7; Fzd7; PFTAIRE protein kinase 2; PFTAIRE2; PFTK2; serine/threonine protein kinase; serine/threonine-protein kinase ALS2CR7; Serine/threonine-protein kinase PFTAIRE-2
• Common Name: PFTK2
• Gene Symbol: CDK15
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PRSLHVVWNRLGRVPEAEDLASQMLKGFPRDRVSAQEALVHDYFSALPSQLYQLPDEESLFTVSGVRLKPEMCDLLASYQKGHHPA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining