Invitrogen™ Human PFKM (aa 351-483) Control Fragment Recombinant Protein

Product Code. 30201250

Brand: Invitrogen™ RP101891

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51687 (PA5-51687. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. The protein encoded by this immunoglobulin superfamily gene member is localized in the tight junctions between high endothelial cells. Unlike other proteins in this family, the this protein is unable to adhere to leukocyte cell lines and only forms weak homotypic interactions. The encoded protein is a member of the junctional adhesion molecule protein family and acts as a receptor for another member of this family.

Specifications

• Accession Number: P08237
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5213
• Name: Human PFKM (aa 351-483) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6-phosphofructo-1-kinase; 6-phosphofructokinase type A; 6-phosphofructokinase, muscle type; AI131669; ATP-dependent 6-phosphofructokinase, muscle type; ATP-dependent 6-phosphofructokinase, muscle type {ECO:0000255; ATP-PFK; ATP-PFK {ECO:0000255; GSD7; HAMAP-Rule:MF_03184}; PFK; PFK1; PFK-1; Pfk4; Pfk-4; Pfka; PFK-A; PFKM; Pfk-m; PFKX; Phosphofructo-1-kinase isozyme A; phosphofructokinase 1; phosphofructokinase 4; phosphofructokinase M variant 3/4; phosphofructokinase muscle; phosphofructokinase, muscle; phosphofructokinase, polypeptide X; phosphofructokinase-1 A isozyme; phosphofructokinase-A; phosphofructokinase-M; phosphofructokinase-M (connecting peptide); phosphohexokinase; phosphohexokinase {ECO:0000255; PPP1R122; protein phosphatase 1, regulatory subunit 122
• Common Name: PFKM
• Gene Symbol: PFKM
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CVQVTKDVTKAMDEKKFDEALKLRGRSFMNNWEVYKLLAHVRPPVSKSGSHTVAVMNVGAPAAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSFEQISA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining