Invitrogen™ Human PFDN5 (aa 5-144) Control Fragment Recombinant Protein

Product Code. 30198524

Brand: Invitrogen™ RP89341

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52583 (PA5-52583. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins. Represses the transcriptional activity of MYC.

Specifications

• Accession Number: Q99471
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5204
• Name: Human PFDN5 (aa 5-144) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1190001O17Rik; 1700010A06Rik; c-myc binding protein; c-myc binding protein MM-1; C-myc-binding protein Mm-1; D15Ertd697e; Eig1; EIG-1; MM1; MM-1; Myc modulator 1; myc modulator-1; PFD5; Pfdn5; prefoldin 5; prefoldin subunit 5
• Common Name: PFDN5
• Gene Symbol: PFDN5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: INITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining