Invitrogen™ Human PFDN2 (aa 1-75) Control Fragment Recombinant Protein

Product Code. 30211837

Brand: Invitrogen™ RP94275

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55952 (PA5-55952. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.

Specifications

• Accession Number: Q9UHV9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5202
• Name: Human PFDN2 (aa 1-75) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ESTM27; HSPC231; PFD2; Pfdn2; prefoldin 2; prefoldin subunit 2; similar to prefoldin subunit 2; W48336
• Common Name: PFDN2
• Gene Symbol: PFDN2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining