Invitrogen™ Human PEX7 (aa 1-89) Control Fragment Recombinant Protein

Product Code. 30211702

Brand: Invitrogen™ RP94691

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61908 (PA5-61908. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes the cytosolic receptor for the set of peroxisomal matrix enzymes targeted to the organelle by the peroxisome targeting signal 2 (PTS2). Defects in this gene cause peroxisome biogenesis disorders (PBDs), which are characterized by multiple defects in peroxisome function. There are at least 14 complementation groups for PBDs, with more than one phenotype being observed in cases falling into particular complementation groups. Although the clinical features of PBD patients vary, cells from all PBD patients exhibit a defect in the import of one or more classes of peroxisomal matrix proteins into the organelle. Defects in this gene have been associated with PBD complementation group 11 (PBD-CG11) disorders, rhizomelic chondrodysplasia punctata type 1 (RCDP1), and Refsum disease (RD).

Specifications

• Accession Number: O00628
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5191
• Name: Human PEX7 (aa 1-89) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: MmPE x 7; PBD9B; PCDP1; Peroxin 7; Peroxin-7; peroxisomal biogenesis factor 7; peroxisomal PTS2 receptor; peroxisomal targeting signal 2 receptor; peroxisome biogenesis factor 7; peroxisome targeting signal 2 receptor; Pe x 7; PE x 7 protein; PTS2 receptor; PTS2R; RCDP1; RD
• Common Name: PEX7
• Gene Symbol: PEX7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLILDPDEAGLRLFRSFDWNDGLFDVTWSENNEHVLITCSGD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining