missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30203554

Invitrogen™ Human PEX3 (aa 201-281) Control Fragment Recombinant Protein

Product Code. 30203554
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30203554

Brand: Invitrogen™ RP103314

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84362 (PA5-84362. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Peroxin 3, also known as PEX3 (peroxisomal biogenesis factor 3) or TRG18, is a 373 amino acid multi-pass membrane protein that localizes to peroxisomes and belongs to the Peroxin family. Expressed ubiquitously, Peroxin 3 interacts with Peroxin 19 and is involved in peroxisome biosynthesis and membrane vesicle assembly, as well as in the maintenance of peroxisomal integrity. Additionally, Peroxin 3 acts as a docking factor for Peroxin 19 and is required for the import of peroxisomal proteins. Defects in the gene encoding Peroxin 3 are the cause of peroxisome biogenesis disorder complementation group 12 (PBD-CG12) and Zellweger syndrome (ZwS), both of which arise from a failure of peroxisomal protein import.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P56589
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8504
Name Human PEX3 (aa 201-281) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1700014F15Rik; 2810027F19Rik; 2900010N04Rik; PBD10A; Peroxin3; peroxin-3; peroxisomal assembly protein 3; peroxisomal assembly protein PEX3; Peroxisomal biogenesis factor 3; pex3; transformation-related protein 18; TRG18; zgc:56313
Common Name PEX3
Gene Symbol PEX3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SLLDLEQKLKEIRNLVEQHKSSSWINKDGSKPLLCHYMMPDEETPLAVQACGLSPRDITTIKLLNETRDMLESPDFSTVLN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.