Invitrogen™ Human PEX16 (aa 133-221) Control Fragment Recombinant Protein

Product Code. 30211433

Brand: Invitrogen™ RP97322

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60311 (PA5-60311. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PEX16 is required for peroxisome membrane biogenesis. It may play a role in early stages of peroxisome assembly and can recruit other peroxisomal proteins, such as PEX3 and PMP34, to de novo peroxisomes derived from the endoplasmic reticulum (ER). It may function as receptor for PEX3.

Specifications

• Accession Number: Q9Y5Y5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9409
• Name: Human PEX16 (aa 133-221) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: PBD8A; PBD8B; peroxin 16; peroxin-16; Peroxisomal biogenesis factor 16; peroxisomal membrane protein PEX16; peroxisome biogenesis factor 16; Pex16
• Common Name: PEX16
• Gene Symbol: PEX16
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AGLQTSPPIVPLDRETQAQPPDGDHSPGNHEQSYVGKRSNRVVRTLQNTPSLHSRHWGAPQQREGRQQQHHEELSATPTPLGLQETIAE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining