Invitrogen™ Human Periostin (aa 193-326) Control Fragment Recombinant Protein

Product Code. 30208645

Brand: Invitrogen™ RP89721

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82458 (PA5-82458. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Periostin (PN), also designated osteoblast-specific factor 2 (OSF-2), is a disulfide linked protein originally isolated as a osteoblast-specific factor. Periostin is a secreted protein that binds heparin and functions as a ligand for alpha(V)beta(3) and alpha(V)beta(5) integrins. In preosteoblasts, Periostin acts as a cell adhesion molecule and plays a role in osteoblast recruitment, spreading and attachment. Periostin is mainly detected in lower gastrointestinal tract, aorta, stomach, placenta, uterus and breast tissues but is up-regulated in epithelial ovarian tumors and overexpressed in breast cancer. Expression of Periostin is increased by bone morphogenetic protein (BMP2) and transforming growth factor beta 1(TGF beta 1). Periostin contains a typical signal sequence, followed by a cysteine-rich domain, a fourfold repeated domain, which shows homology with the insect protein fasciclin, and a C-terminal domain.

Specifications

• Accession Number: Q15063
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10631
• Name: Human Periostin (aa 193-326) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A630052E07Rik; AI747096; fasciclin I-like; Fasciclin-I like; LOW QUALITY PROTEIN: periostin; MGC119510; MGC119511; OSF 2; Osf2; OSF-2; osteoblast specific factor 2; osteoblast specific factor 2 (fasciclin I-like); osteoblast-specific factor 2; PDLPOSTN; peri; periodontal ligament-specific periostin; periostin; periostin variant 1; periostin variant 2; periostin variant 3; periostin variant 4; periostin variant 5; periostin variant 6; periostin variant 7; periostin variant 8; periostin variant 9; periostin, osteoblast specific factor; periostin-like factor; Plf; PN; POSTN; POSTN protein; RP11 412K4.1; RP11-412K4.1
• Common Name: Periostin
• Gene Symbol: Postn
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GLFINHYPNGVVTVNCARIIHGNQIATNGVVHVIDRVLTQIGTSIQDFIEAEDDLSSFRAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASEALMKYHILNTLQCSESIMGGAVFETLEG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining