missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Periostin (aa 193-326) Control Fragment Recombinant Protein

Product Code. 30208645
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30208645

Brand: Invitrogen™ RP89721

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82458 (PA5-82458. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Periostin (PN), also designated osteoblast-specific factor 2 (OSF-2), is a disulfide linked protein originally isolated as a osteoblast-specific factor. Periostin is a secreted protein that binds heparin and functions as a ligand for alpha(V)beta(3) and alpha(V)beta(5) integrins. In preosteoblasts, Periostin acts as a cell adhesion molecule and plays a role in osteoblast recruitment, spreading and attachment. Periostin is mainly detected in lower gastrointestinal tract, aorta, stomach, placenta, uterus and breast tissues but is up-regulated in epithelial ovarian tumors and overexpressed in breast cancer. Expression of Periostin is increased by bone morphogenetic protein (BMP2) and transforming growth factor beta 1(TGF beta 1). Periostin contains a typical signal sequence, followed by a cysteine-rich domain, a fourfold repeated domain, which shows homology with the insect protein fasciclin, and a C-terminal domain.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q15063
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10631
Name Human Periostin (aa 193-326) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A630052E07Rik; AI747096; fasciclin I-like; Fasciclin-I like; LOW QUALITY PROTEIN: periostin; MGC119510; MGC119511; OSF 2; Osf2; OSF-2; osteoblast specific factor 2; osteoblast specific factor 2 (fasciclin I-like); osteoblast-specific factor 2; PDLPOSTN; peri; periodontal ligament-specific periostin; periostin; periostin variant 1; periostin variant 2; periostin variant 3; periostin variant 4; periostin variant 5; periostin variant 6; periostin variant 7; periostin variant 8; periostin variant 9; periostin, osteoblast specific factor; periostin-like factor; Plf; PN; POSTN; POSTN protein; RP11 412K4.1; RP11-412K4.1
Common Name Periostin
Gene Symbol Postn
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GLFINHYPNGVVTVNCARIIHGNQIATNGVVHVIDRVLTQIGTSIQDFIEAEDDLSSFRAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASEALMKYHILNTLQCSESIMGGAVFETLEG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.