Invitrogen™ Human PER2 (aa 490-585) Control Fragment Recombinant Protein

Product Code. 30198616

Brand: Invitrogen™ RP108899

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PER2, also known as Period circadian protein homolog 2, is a mainly nuclear protein that shows nucleocytoplasmic shuttling which is effected by interaction with other circadian core oscillator proteins and/or by phosphorylation. PER2 belongs to the basic helix-loop-helix family of transcription factors and contains a PAC (PAS-associated C-terminal) domain and two PAS (PER-ARNT-SIM) domains. PER2 is a component of the circadian core oscillator, which includes the CRY proteins, CLOCK or NPAS2, BMAL1 or BMAL2, CSNK1D and/or CSNK1E, TIMELESS, and the PER proteins. This protein is thus essential for generating circadian rhythms and is a negative element in the circadian transcriptional loop which influences clock function by interacting with other circadian regulatory proteins and transporting them to the nucleus. Expression of PER2 is fairly wide spread with strong expression in skeletal muscle and pancreas and slight expression in lung. Defects in PER2 are a cause of familial advanced sleep-phase syndrome (FASPS).

Specifications

• Accession Number: O15055
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8864
• Name: Human PER2 (aa 490-585) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: circadian clock protein PERIOD 2; FASPS; FASPS1; hPER2; KIAA0347; mKIAA0347; mPer2; PER2; per2 {ECO:0000312; period 2; period circadian clock 2; period circadian protein 2; period circadian protein homolog 2; period circadian regulator 2; period homolog 2; RGD:61945}; rPER2
• Common Name: PER2
• Gene Symbol: Per2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SHEHLMSQTSSSDSNGHEDSRRRRAEICKNGNKTKNRSHYSHESGEQKKKSVTEMQTNPPAEKKAVPAMEKDSLGVSFPEELACKNQPTCSYQQIS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining