Invitrogen™ Human Peptidylarginine Deiminase (aa 495-550) Control Fragment Recombinant Protein

Product Code. 30203090

Brand: Invitrogen™ RP103444

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64014 (PA5-64014. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the peptidyl arginine deiminase family of enzymes, which catalyze the post-translational deimination of proteins by converting arginine residues into citrullines in the presence of calcium ions. The family members have distinct substrate specificities and tissue-specific expression patterns. The type I enzyme is involved in the late stages of epidermal differentiation, where it deiminates filaggrin and keratin K1, which maintains hydration of the stratum corneum, and hence the cutaneous barrier function. This enzyme may also play a role in hair follicle formation. This gene exists in a cluster with four other paralogous genes.

Specifications

• Accession Number: Q9ULC6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 29943
• Name: Human Peptidylarginine Deiminase (aa 495-550) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: HPAD10; hPAD-colony 10; PAD1; PADI1; PADI5; PDI; PDI1; PDI2; PDI3; PDI4; peptidyl arginine deiminase 1; peptidyl arginine deiminase, type I; peptidylarginine deiminase I; Protein-arginine deiminase type I; protein-arginine deiminase type-1
• Common Name: Peptidylarginine Deiminase
• Gene Symbol: PADI1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PSACLKLFQEKKEEGYGEAAQFDGLKHQAKRSINEMLADRHLQRDNLHAQKCIDWN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining