Invitrogen™ Human PENK (aa 25-146) Control Fragment Recombinant Protein

Product Code. 30200437

Brand: Invitrogen™ RP89939

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53021 (PA5-53021. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

neuropeptide hormone; plays a role in the responses to stress and pain perception.

Specifications

• Accession Number: P01210
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5179
• Name: Human PENK (aa 25-146) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI326464; ENK; enkephalin; enkephalin A; Leu-enkephalin; Met-enkephalin; Met-enkephalin-Arg-Gly-Leu; Met-enkephalin-Arg-Phe; Met-enkephalin-Arg-Ser-Leu; OGF; Opioid growth factor; PE; Penk; PENK(114-133); PENK(143-183); PENK(143-184); PENK(143-185); PENK(237-258); PENK(238-259); PENK(239-260); Penk1; Penk2; PENK-A; Penk-rs; PPA; preproenkephalin; preproenkephalin 1; preproenkephalin 2; proenkephalin; proenkephalin 1; proenkephalin 2; proenkephalin related sequence; proenkephalin-A; spermatogenic-specific proenkephalin; Synenkephalin
• Common Name: PENK
• Gene Symbol: PENK
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ECSQDCATCSYRLVRPADINFLACVMECEGKLPSLKIWETCKELLQLSKPELPQDGTSTLRENSKPEESHLLAKRYGGFMKRYGGFMKKMDELYPMEPEEEANGSEILAKRYGGFMKKDAEE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining