Invitrogen™ Human PEMT (aa 112-156) Control Fragment Recombinant Protein

Product Code. 30195901

Brand: Invitrogen™ RP91146

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59961 (PA5-59961. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes an enzyme which converts phosphatidylethanolamine to phosphatidylcholine by sequential methylation in the liver. The protein localizes to the endoplasmic reticulum and mitochondria-associated membranes. The gene is within the Smith-Magenis syndrome region on chromosome 17. Alternate splicing of this gene results in three transcript variants encoding two different isoforms.

Specifikationer

• Accession Number: Q9UBM1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10400
• Name: Human PEMT (aa 112-156) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: MGC2483; PEAMT; PEMPT; Pempt2; PEMT; PEMT2; PHOMETH; phosphatidylethanolamine N-methyltransferase; phosphatidylethanolamine N-methyltransferase-like protein; phospholipid methyltransferase; PLMT; PNMT; similar to phosphatidylethanolamine N-methyltransferase; zgc:55479
• Common Name: PEMT
• Gene Symbol: PEMT
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GFAGTFLGDYFGILKEARVTVFPFNILDNPMYWGSTANYLGWAIM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining