Invitrogen™ Human Pellino 3 (aa 89-125) Control Fragment Recombinant Protein

Product Code. 30205467

Brand: Invitrogen™ RP103442

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64012 (PA5-64012. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Pellino 1 is the mammalian homologue of Pellino, a Drosophila Pelle-interacting protein. Pelle is a serine-threonine kinase through which Toll signaling can occur. Pellino 1 can activate c-Jun, Elk-1 and NF-kB, whereas Pellino 3 can only activate c-Jun and Elk-1(2).

Specifications

• Accession Number: Q8N2H9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 246330
• Name: Human Pellino 3 (aa 89-125) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6030441F14Rik; A930011L17; BC028931; E3 ubiquitin-protein ligase pellino homolog 3; E3 ubiquitin-protein ligase pellino homolog 3 pseudogene; MGC35521; PELI3; pellino 3; pellino E3 ubiquitin protein ligase family member 3; pellino homolog 3; pellino-3; protein pellino homolog 3; RGD1305989; RING-type E3 ubiquitin transferase pellino homolog 3
• Common Name: Pellino 3
• Gene Symbol: PELI3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RSRLALSRRSHANGVKPDVMHHISTPLVSKALSNRGQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining