Invitrogen™ Human PEF1 (aa 21-85) Control Fragment Recombinant Protein

Product Code. 30203283

Brand: Invitrogen™ RP105196

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84508 (PA5-84508. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PEF1 is a Ca(2+)-binding protein that belongs to the penta-EF-hand (PEF) protein family, which includes the calpain small subunit (CAPNS1), sorcin (SRI), grancalcin (GCA), and ALG2. PEF1 is a Ca(2+)-binding protein that belongs to the penta-EF-hand (PEF) protein family, which includes the calpain small subunit (CAPNS1), sorcin (SRI), grancalcin (GCA), and ALG2 (PDCD6) (Kitaura et al., 2001 ).

Specifications

• Accession Number: Q9UBV8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 553115
• Name: Human PEF1 (aa 21-85) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2600002E23Rik; ABP32; PEF protein with a long N-terminal hydrophobic domain; Pef1; PEF1A; Peflin; peflin; LOW QUALITY PROTEIN: peflin; penta-EF hand domain containing 1; penta-EF hand domain-containing protein 1; penta-EF-hand domain containing 1; UNQ1845/PRO3573; zgc:100787
• Common Name: PEF1
• Gene Symbol: PEF1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PPGSYYPGPPNSGGQYGSGLPPGGGYGGPAPGGPYGPPAGGGPYGHPNPGMFPSGTPGGPYGGAA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining