Invitrogen™ Human PEA15 (aa 56-124) Control Fragment Recombinant Protein

Product Code. 30201567

Brand: Invitrogen™ RP94405

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110955 (PA5-110955. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PEA15 is a death effector domain (DED)-containing protein predominantly expressed in the central nervous system, particularly in astrocytes.

Specifications

• Accession Number: Q15121
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8682
• Name: Human PEA15 (aa 56-124) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 15 kDa phosphoprotein enriched in astrocytes; astrocytic phosphoprotein PEA-15; HMAT1; homolog of mouse MAT-1 oncogene; HUMMAT1H; mammary transforming gene 1; mammary transforming gene 1, mouse, homolog of; MAT1; MAT1H; OTTHUMP00000029887; Pea15; PEA-15; Pea15a; PED; phosphoprotein enriched in astrocytes 15; phosphoprotein enriched in astrocytes 15 A; phosphoprotein enriched in diabetes; Pkcs15; proliferation and apoptosis adaptor protein 15
• Common Name: PEA15
• Gene Symbol: PEA15
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining