missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PDZK1 (aa 189-298) Control Fragment Recombinant Protein

Product Code. 30197597
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30197597

Brand: Invitrogen™ RP88793

Please to purchase this item. Need a web account? Register with us today!

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52199 (PA5-52199. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PDZK1 is a scaffold protein that connects plasma membrane proteins and regulatory components, regulating their surface expression in epithelial cells apical domains. It may be involved in the coordination of a diverse range of regulatory processes for ion transport and second messenger cascades. In complex with SLC9A3R1, it may cluster proteins that are functionally dependent in a mutual fashion and modulate the trafficking and the activity of the associated membrane proteins. It may also play a role in the cellular mechanisms associated with multidrug resistance through its interaction with ABCC2 and PDZK1IP1. May potentiate the CFTR chloride channel activity. PDZK1 functions to connect SCARB1 with the cellular machineries for intracellular cholesterol transport and/or metabolism and may be involved in the regulation of proximal tubular Na(+)-dependent inorganic phosphate cotransport therefore playing an important role in tubule function.
TRUSTED_SUSTAINABILITY

Especificaciones

Accession Number Q5T2W1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5174
Name Human PDZK1 (aa 189-298) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1700023D20Rik; 2610507N21Rik; 4921513F16Rik; AI267131; AI314638; AL022680; CAP70; CFTR-associated protein of 70 kDa; Clamp; C-terminal linking and modulating protein; C-terminal-linking and modulating protein; D3Ertd537e; Dietary Pi-regulated RNA-1; Diphor1; diphor-1; mPDZK1; Na(+)/H(+) exchange regulatory cofactor NHE-RF3; Na(+)/H(+) exchanger regulatory factor 3; Na/Pi cotransporter C-terminal-associated protein 1; NaPi-C; naPi-Cap1; NHERF3; NHERF-3; PDZ domain containing 1; PDZ domain-containing protein 1; PDZ-containing kidney protein 1; Pdzd1; PDZK 1; Pdzk1; PDZK-1; Sodium-hydrogen exchanger regulatory factor 3
Common Name PDZK1
Gene Symbol PDZK1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EDASHEEVVEKVKKSGSRVMFLLVDKETDKRHVEQKIQFKRETASLKLLPHQPRIVEMKKGSNGYGFYLRAGSEQKGQIIKDIDSGSPAEEAGLKNNDLVVAVNGESVET
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado