missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PDZD2 (aa 2257-2356) Control Fragment Recombinant Protein

Product Code. 30195290
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30195290

Brand: Invitrogen™ RP102721

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (62%), Rat (62%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57692 (PA5-57692. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Proteins containing PDZ domains have been shown frequently to bind the C-termini of transmembrane receptors or ion channels. They have also been shown to bind to other PDZ domain proteins and could possibly be involved in intracellular signaling. The protein encoded by this gene contains six PDZ domains and shares sequence similarity with pro-interleukin-16 (pro-IL-16). Like pro-IL-16, the encoded protein localizes to the endoplasmic reticulum and is thought to be cleaved by a caspase to produce a secreted peptide containing two PDZ domains. In addition, this gene is upregulated in primary prostate tumors and may be involved in the early stages of prostate tumorigenesis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O15018
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23037
Name Human PDZD2 (aa 2257-2356) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4930537L06Rik; A930022H17Rik; activated in prostate cancer protein; AIPC; Gm82; KIAA0300; mKIAA0300; PAPIN; PDZ domain containing 2; PDZ domain containing 3; PDZ domain-containing protein 2; PDZ domain-containing protein 3; PDZD2; PDZK3; Pin1; Plakophilin-related armadillo repeat protein-interacting PDZ protein; plakophilin-related armadillo repeat protein-interactive PDZ protein; Processed PDZ domain-containing protein 2
Common Name PDZD2
Gene Symbol PDZD2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VVPEAKASRGGLPSLANGQGIYSVKPLLDTSRNLPATDEGDIISVQETSCLVTDKIKVTRRHYCYEQNWPHESTSFFSVKQRIKSFENLANADRPVAKSG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.