missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PDXK (aa 132-205) Control Fragment Recombinant Protein

Product Code. 30197456
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30197456

Brand: Invitrogen™ RP95173

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56393 (PA5-56393. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Pyridoxal kinase (PDXK) converts vitamin B6 to pyridoxal-5-phosphate (PLP), an essential cofactor in the intermediate metabolism of amino acids and neurotransmitters. The PDXK gene encodes a 312-amino acid polypeptide, and expression of the cDNA reveals pyridoxal kinase activity. Northern blot analysis revealed that a major 1.5-kb PDXK transcript is expressed in all tissues tested. The expression of PDXK shows circadian oscillations. The expression of Pdxk in mouse liver and brain is regulated by the 3 PAR bZIP transcription factors, Dbp, Hlf, and Tef, which also show circadian oscillations in expression. Mice devoid of all 3 transcription factors show decreased levels of brain PLP, serotonin, and dopamine, and are highly susceptible to frequently lethal generalized spontaneous and audiogenic epilepsies.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O00764
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8566
Name Human PDXK (aa 132-205) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310036D04Rik; AA119688; C21orf124; C21orf97; C77999; epididymis secretory sperm binding protein Li 1 A; HEL-S-1 A; Pdxk; Pkh; PNK; PRED79; pyridoxal (pyridoxine, vitamin B6) kinase; pyridoxal kinase; pyridoxamine kinase; pyridoxine kinase; vitamin B6 kinase
Common Name PDXK
Gene Symbol PDXK
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.