Invitrogen™ Human PDX1 (aa 64-127) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30197372	100 μL	100µL

Product Code. 30197372 Supplier Invitrogen™ Supplier No. RP103346

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84405 (PA5-84405. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a transcriptional activator of several genes, including insulin, somatostatin, glucokinase, islet amyloid polypeptide, and glucose transporter type 2. The encoded nuclear protein is involved in the early development of the pancreas and plays a major role in glucose-dependent regulation of insulin gene expression. Defects in this gene are a cause of pancreatic agenesis, which can lead to early-onset insulin-dependent diabetes mellitus (NIDDM), as well as maturity onset diabetes of the young type 4 (MODY4).

Specifications

• Accession Number: P52945
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3651
• Name: Human PDX1 (aa 64-127) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: DLDBP; E3BP; Glucose-sensitive factor; GSF; Idx1; IDX-1; Insulin promoter factor 1; insulin promoter factor 1, homeodomain transcription factor; insulin promotor factor 1; insulin upstream factor 1; Ipf1; IPF-1; Islet/duodenum homeobox 1; islet/duodenum homeobox-1; IUF1; IUF-1; MODY4; PAGEN1; Pancreas/duodenum homeobox protein 1; pancreatic and duodenal homeobox 1; pancreatic and duodenal homeobox gene 1; pancreatic-duodenal homeobox factor 1; PDHX; PDX1; pdx-1; somatostatin transactivating factor 1; somatostatin transcription factor 1; somatostatin-transactivating factor 1; Stf1; STF-1
• Common Name: PDX1
• Gene Symbol: PDX1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DISPYEVPPLADDPAVAHLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFPWMKSTKA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining