missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PDX1 (aa 64-127) Control Fragment Recombinant Protein

Product Code. 30197372
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30197372 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30197372 Supplier Invitrogen™ Supplier No. RP103346

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84405 (PA5-84405. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a transcriptional activator of several genes, including insulin, somatostatin, glucokinase, islet amyloid polypeptide, and glucose transporter type 2. The encoded nuclear protein is involved in the early development of the pancreas and plays a major role in glucose-dependent regulation of insulin gene expression. Defects in this gene are a cause of pancreatic agenesis, which can lead to early-onset insulin-dependent diabetes mellitus (NIDDM), as well as maturity onset diabetes of the young type 4 (MODY4).
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P52945
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3651
Name Human PDX1 (aa 64-127) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias DLDBP; E3BP; Glucose-sensitive factor; GSF; Idx1; IDX-1; Insulin promoter factor 1; insulin promoter factor 1, homeodomain transcription factor; insulin promotor factor 1; insulin upstream factor 1; Ipf1; IPF-1; Islet/duodenum homeobox 1; islet/duodenum homeobox-1; IUF1; IUF-1; MODY4; PAGEN1; Pancreas/duodenum homeobox protein 1; pancreatic and duodenal homeobox 1; pancreatic and duodenal homeobox gene 1; pancreatic-duodenal homeobox factor 1; PDHX; PDX1; pdx-1; somatostatin transactivating factor 1; somatostatin transcription factor 1; somatostatin-transactivating factor 1; Stf1; STF-1
Common Name PDX1
Gene Symbol PDX1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DISPYEVPPLADDPAVAHLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFPWMKSTKA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.