Invitrogen™ Human PDSS1 (aa 35-122) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30193627	100 μL	100µL

Product Code. 30193627 Supplier Invitrogen™ Supplier No. RP104758

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (53%), Rat (53%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65340 (PA5-65340. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PDSS1 is an enzyme that elongates the prenyl side-chain of coenzyme Q, or ubiquinone, one of the key elements in the respiratory chain. PDSS1 catalyzes the formation of all trans-polyprenyl pyrophosphates from isopentyl diphosphate in the assembly of polyisoprenoid side chains, the first step in coenzyme Q biosynthesis. The protein may be peripherally associated with the inner mitochondrial membrane, though no transit peptide has been definitively identified to date. Defects in PDSS1 gene are a cause of coenzyme Q10 deficiency.The protein encoded by this gene is an enzyme that elongates the prenyl side-chain of coenzyme Q, or ubiquinone, one of the key elements in the respiratory chain. The gene product catalyzes the formation of all trans-polyprenyl pyrophosphates from isopentyl diphosphate in the assembly of polyisoprenoid side chains, the first step in coenzyme Q biosynthesis. The protein may be peripherally associated with the inner mitochondrial membrane, though no transit peptide has been definitively identified to date. Defects in this gene are a cause of coenzyme Q10 deficiency.

Specifications

• Accession Number: Q5T2R2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23590
• Name: Human PDSS1 (aa 35-122) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610203G20Rik; 2700031G06Rik; All-trans-decaprenyl-diphosphate synthase subunit 1; COenzyme Q (ubiquinone) biosynthesis family member (coq-1)-like; coenzyme Q1 homolog; COQ1; COQ10D2; decaprenyl diphdsphate synthase subunit1; decaprenyl diphosphate synthase subunit 1; decaprenyl pyrophosphate synthase subunit 1; decaprenyl pyrophosphate synthetase subunit 1; decaprenyl-diphosphate synthase subunit 1; DPS; Dps1; hDPS1; hypothetical protein LOC550349; LOW QUALITY PROTEIN: decaprenyl-diphosphate synthase subunit 1; mDLP1; MGC70953; mSPS1; PDSS1; polyprenyl pyrophosphate synthetase; prenyl (decaprenyl) diphosphate synthase, subunit 1; prenyl (solanesyl) diphosphate synthase, subunit 1; prenyl diphosphate synthase, subunit 1; RP13-16H11.3; solanesyl-diphosphate synthase subunit 1; SPS; Sps1; subunit 1 of decaprenyl diphosphate synthase; subunit 1 of solanesyl diphosphate synthase; TPRT; TPT; TPT 1; trans-prenyltransferase; trans-prenyltransferase (TPT); trans-prenyltransferase 1; wu:fc11f12; wu:fd05d05; zgc:112058
• Common Name: PDSS1
• Gene Symbol: PDSS1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SAAAEVRAQVHRRKGLDLSQIPYINLVKHLTSACPNVCRISRFHHTTPDSKTHSGEKYTDPFKLGWRDLKGLYEDIRKELLISTSELK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining