Invitrogen™ Human PDS5B (aa 1245-1328) Control Fragment Recombinant Protein

Product Code. 30181521

Brand: Invitrogen™ RP97917

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59029 (PA5-59029. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that interacts with the conserved protein complex termed cohesin. The cohesin complex holds together sister chromatids and facilitates accurate chromosome segregation during mitosis and meiosis. This protein is also a negative regulator of cell proliferation and may be a tumor-suppressor gene.

Specifications

• Accession Number: Q9NTI5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23047
• Name: Human PDS5B (aa 1245-1328) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI646570; androgen induced inhibitor of proliferation; androgen-induced proliferation inhibitor; androgen-induced prostate proliferative shutoff associated protein; androgen-induced prostate proliferative shutoff associated protein AS3; androgen-induced prostate proliferative shutoff-associated protein AS3; androgen-induced shutoff 3; Aprin; As3; AW212954; CG008; Kiaa0979; mKIAA0979; PDS5 cohesin associated factor B; PDS5, regulator of cohesion maintenance, homolog B; PDS5, regulator of cohesion maintenance, homolog B (S. cerevisiae); Pds5b; Sister chromatid cohesion protein PDS5 homolog B
• Common Name: PDS5B
• Gene Symbol: PDS5B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GSQRSRKRGHTASESDEQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMKTSKKGSKKKSGPPAPEEEE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining