Invitrogen™ Human PDHX (aa 186-278) Control Fragment Recombinant Protein

Product Code. 30204840

missing translation for 'mfr': Invitrogen™ RP97305

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83422 (PA5-83422. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The PDHX gene encodes component X of the pyruvate dehydrogenase (PDH) complex. For a detailed description of the pyruvate dehydrogenase complex. The mammalian PDH complex differs from that in E. coli and from the other mammalian alpha-keto acid dehydrogenases by the presence of a 53-kDa protein called protein X. Component X binds to the E3 component of the PDH complex (Robinson et al., 1990 ; Aral et al., 1997 ).

Specifications

• Accession Number: O00330
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8050
• Name: Human PDHX (aa 186-278) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Ac1164; AI481367; component X; Dihydrolipoamide dehydrogenase-binding protein of pyruvate dehydrogenase complex; dihydrolipoamide dehydrogenase-binding protein of pyruvate dehydrogenase complex (E3-binding protein) (proX); DLDBP; E3-binding protein; E3BP; GSF; IDX-1; IPF1; IPF-1; IUF-1; lipoyl-containin; lipoyl-containing pyruvate dehydrogenase complex component X; OPDX; Pdhx; PDX1; PDX-1; proX; pyruvate dehydrogenase; pyruvate dehydrogenase complex component X; pyruvate dehydrogenase complex, component X; pyruvate dehydrogenase complex, E3-binding protein subunit; pyruvate dehydrogenase complex, lipoyl-containing component X; pyruvate dehydrogenase protein x component, mitochondrial; STF-1
• Common Name: PDHX
• Gene Symbol: Pdhx
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PAARNILEKHSLDASQGTATGPRGIFTKEDALKLVQLKQTGKITESRPTPAPTATPTAPSPLQATAGPSYPRPVIPPVSTPGQPNAVGTFTEI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining