missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PDHX (aa 103-185) Control Fragment Recombinant Protein

Product Code. 30210641
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210641

Brand: Invitrogen™ RP97306

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83421 (PA5-83421. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The PDHX gene encodes component X of the pyruvate dehydrogenase (PDH) complex. For a detailed description of the pyruvate dehydrogenase complex. The mammalian PDH complex differs from that in E. coli and from the other mammalian alpha-keto acid dehydrogenases by the presence of a 53-kDa protein called protein X. Component X binds to the E3 component of the PDH complex (Robinson et al., 1990 ; Aral et al., 1997 ).
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O00330
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8050
Name Human PDHX (aa 103-185) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Ac1164; AI481367; component X; Dihydrolipoamide dehydrogenase-binding protein of pyruvate dehydrogenase complex; dihydrolipoamide dehydrogenase-binding protein of pyruvate dehydrogenase complex (E3-binding protein) (proX); DLDBP; E3-binding protein; E3BP; GSF; IDX-1; IPF1; IPF-1; IUF-1; lipoyl-containin; lipoyl-containing pyruvate dehydrogenase complex component X; OPDX; Pdhx; PDX1; PDX-1; proX; pyruvate dehydrogenase; pyruvate dehydrogenase complex component X; pyruvate dehydrogenase complex, component X; pyruvate dehydrogenase complex, E3-binding protein subunit; pyruvate dehydrogenase complex, lipoyl-containing component X; pyruvate dehydrogenase protein x component, mitochondrial; STF-1
Common Name PDHX
Gene Symbol Pdhx
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DASDDGILAKIVVEEGSKNIRLGSLIGLIVEEGEDWKHVEIPKDVGPPPPVSKPSEPRPSPEPQISIPVKKEHIPGTLRFRLS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.