Invitrogen™ Human PDGFRB (aa 76-169) Control Fragment Recombinant Protein

Product Code. 30199943

Brand: Invitrogen™ RP95201

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PDGFRB is a receptor tyrosine kinase and has been implicated in atherogenesis and in cell transformation by the SIS oncogene. These growth factors are mitogens for cells of mesenchymal origin. The identity of the growth factor bound to a receptor monomer determines whether the functional receptor is a homodimer or a heterodimer, composed of both platelet-derived growth factor receptor alpha and beta polypeptides. The gene is flanked on chromosome 5 by the genes for granulocyte-macrophage colony-stimulating factor and macrophage-colony stimulating factor receptor; all three genes may be implicated in the 5-q syndrome. A translocation between chromosomes 5 and 12, that fuses PDGFRB (CD140b) to that of the translocation, ETV6, leukemia gene, results in chronic myeloproliferative disorder with eosinophilia.

Specifications

• Accession Number: P09619
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5159
• Name: Human PDGFRB (aa 76-169) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI528809; Beta platelet-derived growth factor receptor; beta-type platelet-derived growth factor receptor; CD140 antigen-like family member B; CD140B; CD140b antigen; IBGC4; IMF1; JTK12; KOGS; PDGF beta chain; PDGF Receptor beta; Pdgfr; Pdgfr1; PDGFR-1; PDGFRB; PDGF-R-beta; PDGFR-beta; PENTT; platelet derived growth factor receptor beta; platelet derived growth factor receptor, beta polypeptide; platelet-derived growth factor receptor 1; Platelet-derived growth factor receptor beta; platelet-derived growth factor receptor beta variant 1; Platelet-derived growth factor receptor, beta; platelet-derived growth factor receptor, beta polypeptide
• Common Name: PDGFRB (CD140b)
• Gene Symbol: Pdgfrb
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AQDGTFSSVLTLTNLTGLDTGEYFCTHNDSRGLETDERKRLYIFVPDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDVAL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining