missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PDEF (aa 92-158) Control Fragment Recombinant Protein

Product Code. 30194227
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194227

Brand: Invitrogen™ RP106659

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PDEF (prostate-derived Ets factor) is a 37.5-kDa protein that acts as an androgen-independent transcriptional activator for the PSA (prostate specific antigen) promoter. It also interacts directly with the DNA binding domain of androgen receptor and enhances androgen-mediated activation of the PSA promoter. PDEF was shown to have transcript levels 192-fold higher in the peripheral blood of some breast cancer patients in comparison with normal individuals. PDEF mRNA is also frequently over-expressed in human breast tumors as well as in human ovarian tumors. In ovarian tumors, PDEF expression seems to down-modulate malignant potential, and thus provides a rationale to screen for drugs that induce PDEF expression in epithelial ovarian tumors.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O95238
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 25803
Name Human PDEF (aa 92-158) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias bA375E1.3; PDEF; Prostate epithelium-specific Ets transcription factor; prostate specific ets transcription factor; prostate-derived Ets factor; Prostate-specific Ets; Pse; SAM pointed domain containing ets transcription factor; SAM pointed domain-containing Ets transcription factor; SPDEF
Common Name PDEF
Gene Symbol Spdef
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKW
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.