Invitrogen™ Human PDE8B (aa 94-174) Control Fragment Recombinant Protein

Product Code. 30194721

Brand: Invitrogen™ RP105930

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65182 (PA5-65182. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cyclic nucleotide phosphodiesterases (PDEs) catalyze hydrolysis of the 5-prime,3-prime-cyclic nucleotides cAMP and cGMP to the corresponding nucleoside 5-prime-monophosphates. Mammalian PDEs have been grouped into several families based on substrate affinities, inhibitor sensitivities, mode of regulation, and amino acid sequence homologies. The PDE8 family contains high-affinity cAMP-specific, IBMX (3-isobutyl-1-methyl-xanthine)-insensitive PDEs, such as PDE8B. All PDEs share a conserved C-terminal catalytic region and a variable N-terminal domain that presumably accounts for the distinctive regulatory properties unique to the individual families.

Specifications

• Accession Number: O95263
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8622
• Name: Human PDE8B (aa 94-174) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3',5' cyclic nucleotide phosphodiesterase 8 B; ADSD; B230331L10Rik; C030047E14Rik; cAMP-specific cyclic nucleotide phosphodiesterase PDE8; cell proliferation-inducing gene 22 protein; FLJ11212; High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8 B; hsPDE8B; Pde8b; phosphodiesterase 8 B; PIG22; PPNAD3; RNPDE8B
• Common Name: PDE8B
• Gene Symbol: PDE8B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RRHCCSSAEAETQTCYTSVKQVSSAEVRIGPMRLTQDPIQVLLIFAKEDSQSDGFWWACDRAGYRCNIARTPESALECFLD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining