Invitrogen™ Human PDE6D (aa 79-147) Control Fragment Recombinant Protein

Product Code. 30202005

Brand: Invitrogen™ RP96157

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PrBP/delta, previously known as PDE6/delta, is the effector enzyme in the G protein-mediated signal transduction cascade in the visual system. There are five different subunits consisting of rod and cone specific catalytic subunits: alpha (Cone), alpha (Rod), and beta (Rod), the inhibitory subunit gamma, and subunit delta of unknown function (which likely interacts with many other proteins besides the PDE6 family). PRBP/delta has been implicated in the transport and membrane targeting of prenylated proteins (including PDE6) from their site of synthesis in the inner segment to their final destination in the outer segment of rods and cones (Norton et. al., 2005).

Specifications

• Accession Number: O43924
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5147
• Name: Human PDE6D (aa 79-147) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI841218; GMP-PDE delta; JBTS22; PDE6D; PDED; phosphodiesterase 6 D; phosphodiesterase 6 D, cGMP-specific, rod, delta; PrBP/delta; Protein p17; retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta; rod phosphodiesterase delta subunit
• Common Name: PDE6D
• Gene Symbol: PDE6D
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLVSTSRVRL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining