Invitrogen™ Human PDE6A (aa 418-560) Control Fragment Recombinant Protein

Product Code. 30207150

Brand: Invitrogen™ RP88965

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes the cyclic-GMP (cGMP)-specific phosphodiesterase 6A alpha subunit, expressed in cells of the retinal rod outer segment. The phosphodiesterase 6 holoenzyme is a heterotrimer composed of an alpha, beta, and two gamma subunits. cGMP is an important regulator of rod cell membrane current, and its dynamic concentration is established by phosphodiesterase 6A cGMP hydrolysis and guanylate cyclase cGMP synthesis. The protein is a subunit of a key phototransduction enzyme and participates in processes of transmission and amplification of the visual signal. Mutations in this gene have been identified as one cause of autosomal recessive retinitis pigmentosa.

Specifications

• Accession Number: P16499
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5145
• Name: Human PDE6A (aa 418-560) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: cGMP phosphodiesterase alpha; cGMP phosphodiesterase alpha subunit; cGMP phosphodiesterase alpha subunit (EC 3.1.4.35); CGPR-A; cyclic GMP phosphodiesterase alpha subunit; GMP phosphodiesterase alpha subunit; GMP-PDE alpha; nmf282; PDE V-B1; PDE6A; PDEA; phosphodiesterase 6 A; phosphodiesterase 6 A, cGMP-specific, rod, alpha; phosphodiesterase, cyclic GMP (rod receptor), alpha polypeptide; rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha; rod photoreceptor cGMP phosphodiesterase alpha subunit; RP43; unnamed protein product
• Common Name: PDE6A
• Gene Symbol: PDE6A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TLMESLTQFLGWSVLNPDTYESMNKLENRKDIFQDIVKYHVKCDNEEIQKILKTREVYGKEPWECEEEELAEILQAELPDADKYEINKFHFSDLPLTELELVKCGIQMYYELKVVDKFHIPQEALVRFMYSLSKGYRKITYHN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining