missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30201803

Invitrogen™ Human PDE4A (aa 188-238) Control Fragment Recombinant Protein

Product Code. 30201803
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201803

Brand: Invitrogen™ RP108069

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111736 (PA5-111736. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cyclic nucleotides are important second messengers that regulate and mediate a number of cellular responses to extracellular signals, such as hormones, light, and neurotransmitters. Cyclic nucleotide phosphodiesterases (PDEs) regulate the cellular concentrations of cyclic nucleotides and thereby play a role in signal transduction. PDE4A is a class IV cAMP-specific PDE.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P27815
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5141
Name Human PDE4A (aa 188-238) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias cAMP-specific 3',5'-cyclic phosphodiesterase 4 A; cAMP-specific phosphodiesterase PDE4A; cyclic AMP specific phosphodiesterase PDE4A5A; cyclic AMP-specific phosphodiesterase OCPDE4A1A; D9Ertd60e; DPDE2; dunce; LOC100009247; PDE4; PDE46; Pde4a; PHOSA; phosphodiesterase 4 A; phosphodiesterase 4 A, cAMP specific; phosphodiesterase 4 A, cAMP-specific; phosphodiesterase 4 A, cAMP-specific (dunce; phosphodiesterase 4 A, cAMP-specific (phosphodiesterase E2 dunce homolog, Drosophila); phosphodiesterase E2 dunce homolog, Drosophila; phosphodiesterase isozyme 4
Common Name PDE4A
Gene Symbol Pde4a
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LRSVRSNFSLLTNVPVPSNKRSPLGGPTPVCKATLSEETCQQLARETLEEL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.