missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30213329

Invitrogen™ Human PDE3A (aa 1045-1139) Control Fragment Recombinant Protein

Product Code. 30213329
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30213329

Brand: Invitrogen™ RP109399

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cyclic nucleotide phosphodiesterases (PDEs) comprise a complex group of enzymes, and at least 5 major PDE families or classes with distinctive properties have been identified. Members of the cGMP-inhibited cAMP PDE (cGI-PDE) family, such as PDE3A, are characterized by high affinity for cAMP and cGMP and competitive inhibition of their cAMP hydrolytic activity by cGMP and certain positive inotropic agents (Meacci et al., 1992 [PubMed 1315035]).
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q14432
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5139
Name Human PDE3A (aa 1045-1139) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A930022O17Rik; C87899; cAMP phosphodiesterase, myocardial cGMP-inhibited; CGI-PDE; CGI-PDE A; CGI-PDE-A; cGMP-inhibited 3',5'-cyclic phosphodiesterase A; cGMP-inhibited phosphodiesterase; cyclic GMP-inhibited phosphodiesterase A; cyclic nucleotide phosphodiesterase; HTNB; PDE3A; phosphodiesterase 3 A; phosphodiesterase 3 A, cGMP inhibited; phosphodiesterase 3 A, cGMP-inhibited; RNPDE3A
Common Name PDE3A
Gene Symbol PDE3A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EAPAPNEEETCENNESPKKKTFKRRKIYCQITQHLLQNHKMWKKVIEEEQRLAGIENQSLDQTPQSHSSEQIQAIKEEEEEKGKPRGEEIPTQKP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.