Invitrogen™ Human PDE2A (aa 363-461) Control Fragment Recombinant Protein

Product Code. 30205907

Brand: Invitrogen™ RP104153

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56665 (PA5-56665. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PDE2A (phosphodiesterase 2A) is a 100 kD cyclic nucleotide phosphodiesterase (PDE) and three isoforms of PDE2A have been reported (PDE2A1, PDE2A2 and PDE2A3) which arise from a single gene by alternative splicing events. PDE2A can degrade both cAMP and cGMP, but degrades cGMP with greater efficacy. PDE2A is expressed in a variety of tissue types, with greatest expression in the brain, where it is localized in the cerebellum and neocortex. PDE2A has been implicated in penile erectile dysfunction and in the regulation of fluid and inflammatory cell transport across the endothelial cell barrier.

Specifications

• Accession Number: O00408
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5138
• Name: Human PDE2A (aa 363-461) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: c-GMP stimulated phosphodiesterase; cGMP-dependent 3',5'-cyclic phosphodiesterase; cGMP-stimulated cyclic nucleotide phosphodiesterase; cGMP-stimulated phosphodiesterase 1; cGMP-stimulated phosphodiesterase 2; cGMP-stimulated phosphodiesterase 4; cGSPDE; CGS-PDE; cyclic GMP stimulated phosphodiesterase; cyclic GMP-stimulated phosphodiesterase; cyclic nucleotide phosphodiesterase; cyclic nucleotide phosphodiesterase 2 A; Pde2; Pde2a; PDE2A1; Pde2a2; PED2A4; phosphodiesterase 2 A; phosphodiesterase 2 A, cGMP-stimulated
• Common Name: PDE2A
• Gene Symbol: PDE2A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLDQNELVAKVFDGGVVDDESYEIRIPA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining