missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30203171

Invitrogen™ Human PDE1C (aa 425-512) Control Fragment Recombinant Protein

Product Code. 30203171
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30203171

Brand: Invitrogen™ RP92764

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54497 (PA5-54497. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cyclic nucleotide phosphodiesterases (PDEs) catalyze hydrolysis of the cyclic nucleotides cAMP and cGMP to the corresponding nucleoside 5-prime-monophosphates. Mammalian PDEs have been classified into several families based on their biochemical properties. Members of the PDE1 family, such as PDE1C, are calmodulin -dependent PDEs (CaM-PDEs) that are stimulated by a calcium-calmodulin complex (Repaske et al., 1992 ).
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q14123
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5137
Name Human PDE1C (aa 425-512) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 3',5'-cyclic-AMP phosphodiesterase; 3',5'-cyclic-GMP phosphodiesterase; Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1 C; cam-PDE 1 C; cyclic nucleotide phosphodiesterase 1 C; Hcam3; hCam-3; Human 3',5' cyclic nucleotide phosphodiesterase (HSPDE1C1A); PDE1C; phosphodiesterase 1 C; phosphodiesterase 1 C calmodulin-dependent (70 kD); phosphodiesterase 1 C, calmodulin-dependent 70 kDa
Common Name PDE1C
Gene Symbol PDE1C
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QSQVGFIDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKRSGVKTSGSEGSAPINNSVISVDYKSFKATWTE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.