missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30203766

Invitrogen™ Human PCSK1N (aa 51-156) Control Fragment Recombinant Protein

Produktkod. 30203766
Klicka för att se tillgängliga alternativ
Quantity:
100 μL
Förpackningsstorlek:
100µL
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 30203766

Brand: Invitrogen™ RP92330

Please to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52026 (PA5-52026. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene functions as an inhibitor of prohormone convertase 1, which regulates the proteolytic cleavage of neuroendocrine peptide precursors. The proprotein is further processed into multiple short peptides. A polymorphism within this gene may be associated with obesity.
TRUSTED_SUSTAINABILITY

Specifikationer

Accession Number Q9UHG2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 27344
Name Human PCSK1N (aa 51-156) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI848336; basic protein IA-4; Big LEN; big PEN LEN; Big PEN-LEN; Big SAAS; BigLEN; bLEN; b-LEN; b-PEN-LEN; b-SAAS; granin-like neuroendocrine peptide; IA-4; KEP; Little LEN; little SAAS; lLEN; l-LEN; l-SAAS; N-proSAAS; Pan3; pancreas protein 3; Pcsk1n; PEN; PEN19; PEN-19; PEN20; PEN-20; proprotein convertase 1 inhibitor; Proprotein convertase subtilisin/kexin type 1 inhibitor; proSAAS; pro-SAAS; protein serine alanine alanine serine; SAAS; SAAS CT(1-49); SAAS CT(25-40); SAASCT; SCG8; SgVIII
Common Name PCSK1N
Gene Symbol PCSK1N
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AETGAPRRFRRSVPRGEAAGAVQELARALAHLLEAERQERARAEAQEAEDQQARVLAQLLRVWGAPRNSDPALGLDDDPDAPAAQLARALLRARLDPAALAAQLVP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.