missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PCQAP (aa 17-129) Control Fragment Recombinant Protein

Product Code. 30194417
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194417

Brand: Invitrogen™ RP91488

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51848 (PA5-51848. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a transcription factor that represses GATA-regulated genes and binds to a dynein light chain protein. Binding of the encoded protein to the dynein light chain protein affects binding to GATA consensus sequences and suppresses its transcriptional activity. Defects in this gene are a cause of tricho-rhino-phalangeal syndrome (TRPS) types I-III.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96RN5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51586
Name Human PCQAP (aa 17-129) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A230074L19Rik; Activator-recruited cofactor 105 kDa component; activator-recruited cofactor, 105-kD; ARC105; AW536074; CAG7A; CTG repeat protein 7 A; CTG7A; DKFZp686A2214; DKFZp762B1216; FLJ42282; FLJ42935; MED15; Mediator complex subunit 15; mediator of RNA polymerase II transcription subunit 15; mPcqap; PC2 (positive cofactor 2, multiprotein complex) glutamine/Q-rich-associated protein; PC2 glutamine/Q-rich-associated protein; PC2-glutamine-rich-associated protein; PCQAP; Positive cofactor 2 glutamine/Q-rich-associated protein; positive cofactor 2, glutamine/Q-rich-associated protein; positive cofactor 2, multiprotein complex, glutamine/Q-rich-associated protein; TIG1; TIG-1; TNRC7; TPA inducible gene-1; TPA inducible protein; TPA-inducible gene 1 protein; trinucleotide repeat containing 7; trinucleotide repeat-containing gene 7 protein
Common Name PCQAP
Gene Symbol MED15
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQSLTGGPAAGAAGIGMPPRGPGQSLGGMGSLGAMGQPMSLSGQP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.