Invitrogen™ Human PCP2 (aa 22-112) Control Fragment Recombinant Protein

Product Code. 30196898

Brand: Invitrogen™ RP106777

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66082 (PA5-66082. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May function as a cell-type specific modulator for G protein-mediated cell signaling.

Specifications

• Accession Number: Q8IVA1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 126006
• Name: Human PCP2 (aa 22-112) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CTD-3214H19.6; GPSM4; PCP2; Purkinje cell protein 2; Purkinje cell protein 2 homolog; Purkinje cell-specific protein 2; Purkinje cell-specific protein L7
• Common Name: PCP2
• Gene Symbol: PCP2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DQEGFFNLLSHVQGDRMEGQRCSLQAGPGQTTKSQSDPTPEMDSLMDMLASTQGRRMDDQRVTVSSLPGFQPVGSKDGAQKRAGTLSPQPL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining