Invitrogen™ Human PCNXL4 (aa 1047-1172) Control Fragment Recombinant Protein

Product Code. 30206655

Brand: Invitrogen™ RP88904

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51679 (PA5-51679. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q63HM2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 64430
• Name: Human PCNXL4 (aa 1047-1172) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1810048J11Rik; 4932413O10; AU017192; C14orf135; FBP2; HCV F protein-binding protein 2; HCV F-interacting protein; hepatitis C virus F protein-binding protein 2; PCNX4; PCNXL4; pecanex homolog 4 (Drosophila); pecanex homolog protein 4; pecanex-like 4; pecanex-like 4 (Drosophila); pecanex-like protein 4; pecanex-like protein C14orf135; pecanex-like protein C14orf135 homolog; RGD1566114
• Common Name: PCNXL4
• Gene Symbol: PCNX4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ELIKYLEEYERDWYIGLVSDEKWKEAILQEKPYLFSLGYDSNMGIYTGRVLSLQELLIQVGKLNPEAVRGQWANLSWELLYATNDDEERYSIQAHPLLLRNLTVQAAEPPLGYPIYSSKPLHIHLY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining