Invitrogen™ Human PCNXL2 (aa 341-447) Control Fragment Recombinant Protein

Product Code. 30211147

Brand: Invitrogen™ RP90604

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53164 (PA5-53164. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May play a role in tumorigenesis of colorectal carcinomas with high microsatellite instability (MSI-H).

Specifications

• Accession Number: A6NKB5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 80003
• Name: Human PCNXL2 (aa 341-447) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A830048P05; AU067631; E330039K12Rik; KIAA0435; mKIAA0435; PCNX2; Pcnxl2; pecanex 1; pecanex homolog 2 (Drosophila); Pecanex homolog protein 2; pecanex-like 2 (Drosophila); pecanex-like protein 2; RGD1305883
• Common Name: PCNXL2
• Gene Symbol: PCNX2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LPLHQEVDSSDSEVAVTLIDTSQPGDPLSLHEPIKIVITMSSTPNSMTDLESSLHLRVVGTEKTSVKSDAEPTNPGAAGSPNAEQISIPVITLDLPEGGGGGVPCPE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining