Invitrogen™ Human PCK2 (aa 10-101) Control Fragment Recombinant Protein

Product Code. 30198105

Brand: Invitrogen™ RP101158

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84052 (PA5-84052. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the phosphoenolpyruvate carboxykinase (GTP) family. The protein is a mitochondrial enzyme that catalyzes the conversion of oxaloacetate to phosphoenolpyruvate in the presence of GTP. A cytosolic form encoded by a different gene has also been characterized and is the key enzyme of gluconeogenesis in the liver. The encoded protein may serve a similar function, although it is constitutively expressed and not modulated by hormones such as glucagon and insulin that regulate the cytosolic form. Alternatively spliced transcript variants have been described.

Specifications

• Accession Number: Q16822
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5106
• Name: Human PCK2 (aa 10-101) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1810010O14Rik; 9130022B02Rik; HGNC:8725; PCK2; PEP carboxykinase; PEPCK; PEPCK2; PEPCK-M; Phosphoenolpyruvate carboxykinase [GTP], mitochondrial; phosphoenolpyruvate carboxykinase 2 (mitochondrial); phosphoenolpyruvate carboxykinase 2, mitochondrial; phosphoenolpyruvate carboxylase; phosphopyruvate carboxylase
• Common Name: PCK2
• Gene Symbol: PCK2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RLNWHGLSPLGWPSCRSIQTLRVLSGDLGQLPTGIRDFVEHSARLCQPEGIHICDGTEAENTATLTLLEQQGLIRKLPKYNNCWLARTDPKD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining