Invitrogen™ Human PCIF1 (aa 98-189) Control Fragment Recombinant Protein

Product Code. 30198104

Brand: Invitrogen™ RP101151

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61996 (PA5-61996. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PCIF1 may play a role in transcription elongation or in coupling transcription to pre-mRNA processing through its association with the phosphorylated C-terminal domain (CTD) of RNAPII largest subunit.

Specifications

• Accession Number: Q9H4Z3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 63935
• Name: Human PCIF1 (aa 98-189) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310022K11Rik; C20orf67; CAPAM; Cap-specific adenosine methyltransferase; F730014I05Rik; hPCIF1; mRNA (2'-O-methyladenosine-N(6)-)-methyltransferase; Pcif1; PDX-1 C terminus-interacting factor 1; PD x 1 C-terminal inhibiting factor 1; phosphorylated CTD interacting factor PCIF1; phosphorylated CTD-interacting factor 1; PPP1R121; protein phosphatase 1, regulatory subunit 121; RGD1310800
• Common Name: PCIF1
• Gene Symbol: PCIF1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SSLVETPPAENKPRKRQLSEEQPSGNGVKKPKIEIPVTPTGQSVPSSPSIPGTPTLKMWGTSPEDKQQAALLRPTEVYWDLDIQTNAVIKHR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining