Invitrogen™ Human PCBP2 (aa 192-224) Control Fragment Recombinant Protein

Product Code. 30181784

Brand: Invitrogen™ RP97889

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83415 (PA5-83415. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene appears to be multifunctional. Along with PCBP-1 and hnRNPK, it is one of the major cellular poly(rC)-binding proteins. The encoded protein contains three K-homologous (KH) domains which may be involved in RNA binding. Together with PCBP-1, this protein also functions as a translational coactivator of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES, promoting poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. This multiexon structural mRNA is thought to be retrotransposed to generate PCBP-1, an intronless gene with functions similar to that of PCBP2. This gene and PCBP-1 have paralogous genes (PCBP3 and PCBP4) which are thought to have arisen as a result of duplication events of entire genes. This gene also has two processed pseudogenes (PCBP2P1 and PCBP2P2). Multiple transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: Q15366
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5094
• Name: Human PCBP2 (aa 192-224) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Alpha CP2; Alpha-CP2; alphaCP-2; AW412548; CBP; CTBP; fb36h02; Heterogeneous nuclear ribonucleoprotein E2; heterogeneous nuclear ribonucleoprotein X; heterogenous nuclear ribonucleoprotein E2; hnRNP E2; hnRNP X; HNRNPE2; hnRNP-E2; Hnrnpx; HNRPE2; Hnrpx; MGC110998; Pcbp2; pcbp2 protein; PCBP3; poly(rC) binding protein 2; poly(rC)-binding protein 2; Putative heterogeneous nuclear ribonucleoprotein X; rCbinding protein 2; wu:fb36h02; zgc:55964
• Common Name: PCBP2
• Gene Symbol: PCBP2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining