missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30194208

Invitrogen™ Human PCAF (aa 232-282) Control Fragment Recombinant Protein

Product Code. 30194208
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194208

Brand: Invitrogen™ RP106669

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65981 (PA5-65981. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PCAF (histone acetyltransferase KAT2B) functions as a histone acetyltransferase (HAT) to promote transcriptional activation. It has significant histone acetyltransferase activity with core histones (H3 and H4) and nucleosome core particles. PCAF also acetylates non-histone proteins such as ACLY, PLK4, and TBX5. It inhibits cell-cycle progression and counteracts the mitogenic activity of the adenoviral oncoprotein E1A. PCAF also acts as a circadian transcriptional coactivator which enhances the activity of the circadian transcriptional activators NPAS2-ARNTL/BMAL1 and CLOCK-ARNTL/BMAL1 heterodimers. It is involved in heart and limb development by mediating acetylation of TBX5 and acetylation regulating nucleocytoplasmic shutting of TBX5.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q92831
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8850
Name Human PCAF (aa 232-282) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A930006P13Rik; AI461839; AW536563; CAF; CREBBP-associated factor; histone acetylase PCAF; Histone acetyltransferase KAT2B; histone acetyltransferase PCAF; K(lysine) acetyltransferase 2 B; Kat2b; Lysine acetyltransferase 2 B; P/ PCAF; P/CAF; P300/CBP-associated factor; Pcaf; Spermidine acetyltransferase KAT2B
Common Name PCAF
Gene Symbol KAT2B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KFSHLPAKERQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENY
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.