missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30194419

Invitrogen™ Human PC4 (aa 8-117) Control Fragment Recombinant Protein

Product Code. 30194419
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194419

Brand: Invitrogen™ RP95157

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51557 (PA5-51557. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PC4 (activated RNA polymerase II transcription cofactor 4) is a transcriptional coactivator, possessing the ability to suppress promoter-driven as well as nonspecific transcription via its DNA binding activity. The repressive activity of PC4 on promoter-driven transcription is alleviated by transcription factor TFIIH. TFIIH protects promoters from PC4-mediated repression by relieving the topological constraint imposed by PC4 through the ERCC3 helicase activity.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P53999
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10923
Name Human PC4 (aa 8-117) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias activated RNA polymerase II transcription cofactor 4; activated RNA polymerase II transcriptional coactivator p15; AI842364; hypothetical protein LOC553561; p14; P15; P9; Pc4; positive cofactor 4; pR-ET2 encoded oncodevelopmental protein; RNA polymerase II transcriptional coactivator; Rpo2tc1; Single-stranded DNA-binding protein p9; Sub1; SUB1 homolog; SUB1 homolog (S. cerevisiae); SUB1 homolog a; SUB1 homolog, transcriptional regulator; SUB1 homolog, transcriptional regulator a; SUB1 regulator of transcription; SUB1 regulator of transcription a; sub1a; TIS7; zgc:109973
Common Name PC4
Gene Symbol Sub1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.