Invitrogen™ Human PBXIP1 (aa 18-140) Control Fragment Recombinant Protein

Product Code. 30200287

Brand: Invitrogen™ RP89383

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (62%), Rat (62%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52366 (PA5-52366. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Regulator of pre-B-cell leukemia transcription factors (BPXs) function. Inhibits the binding of PBX1-HOX complex to DNA and blocks the transcriptional activity of E2A-PBX1. Tethers estrogen receptor-alpha (ESR1) to microtubules and allows them to influence estrogen receptors-alpha signaling.

Specifications

• Accession Number: Q96AQ6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57326
• Name: Human PBXIP1 (aa 18-140) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4732463H20Rik; hematopoietic PBX-interacting protein; HPIP; PBX homeobox interacting protein 1; PBXIP1; pre B cell leukemia transcription factor interacting protein 1; pre-B-cell leukemia homeobox interacting protein 1; pre-B-cell leukemia transcription factor interacting protein 1; pre-B-cell leukemia transcription factor-interacting protein 1
• Common Name: PBXIP1
• Gene Symbol: PBXIP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SLPVETLGPASRMDPESERALQAPHSPSKTDGKELAGTMDGEGTLFQTESPQSGSILTEETEVKGTLEGDVCGVEPPGPGDTVVQGDLQETTVVTGLGPDTQDLEGQSPPQSLPSTPKAAWIR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining