Invitrogen™ Human PBX2 (aa 364-405) Control Fragment Recombinant Protein

Product Code. 30206002

Brand: Invitrogen™ RP100032

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63964 (PA5-63964. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PBX2 is a ubiquitously expressed member of the TALE/PBX homeobox family. PBX2 gene was identified by its similarity to a homeobox gene which is involved in t(1;19) translocation in acute pre-B-cell leukemias. PBX2 is a transcriptional activator which binds to the TLX1 promoter. This gene encodes a ubiquitously expressed member of the TALE/PBX homeobox family. It was identified by its similarity to a homeobox gene which is involved in t(1;19) translocation in acute pre-B-cell leukemias. This protein is a transcriptional activator which binds to the TLX1 promoter. The gene is located within the major histocompatibility complex (MHC) on chromosome 6.

Specifications

• Accession Number: P40425
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5089
• Name: Human PBX2 (aa 364-405) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AU043397; G17; homeobox 12; homeobox protein PB x 2; HO x 12; PBX homeobox 2; Pb x 2; PB x 2 MHC; PB x 2P1; pbxy; pbxy homeodomain protein; pre B cell leukemia homeobox 2; pre B-cell leukemia transcription factor 2; pre-B-cell leukemia homeobox 2; pre-B-cell leukemia homeobox 2 pseudogene 1; pre-B-cell leukemia homeobox 3; pre-B-cell leukemia transcription factor 2; pre-B-cell leukemia transcription factor 2; pre-B-cell leukemia homeobox 2; pre-B-cell leukemia transcription factor y; Protein G17; wu:fb73g03; XXbac-BPG300A18.13
• Common Name: PBX2
• Gene Symbol: PBX2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GDSYSASQVESLRHSMGPGGYGDNLGGGQMYSPREMRANGSW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining